Daily Trending Keyword - yacht - 2024-03-16

All .com's with the term yacht registered. The term yacht gets about 74,000 searches a month! Generate more domains with the term yacht below!

Here are the domains with yacht in the them. Registered 2024-03-16

  • 4yachting.com
  • athena-yachting.com
  • barmouthtofortwilliamthreepeaksyachtrace.com
  • boatandyachtcharter.com
  • boredmateyachtclub.com
  • caigeeyacht.com
  • croatia-yachts.com
  • floridayachtcaptain.com
  • gravitysuperyacht.com
  • locationyachtsainttropez.com
  • portsmouthyachtservices.com
  • rhodesprivateyacht.com
  • superyachtnavigator.com
  • thebestyachtchartercompany.com
  • thebestyachtcompany.com
  • threepeaksyachtraceuk.com
  • tuscanyyachtdestinations.com
  • tuscanyyachtingdestination.com
  • tuscanyyachtingdestinations.com
  • yacht-and-villa-set.com
  • yacht-consulting.com
  • yacht-diskavery.com
  • yachtchartersandiego.com
  • yachtclubssupp.com
  • yachtcrewaustralia.com
  • yachtkidsclothing.com
  • yachtrentaldubrovnik.com
  • yachts-consulting.com
  • yachtsurveyorsincorporated.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder