Daily Trending Keyword - three - 2024-03-16

All .com's with the term three registered. The term three gets about 33,100 searches a month! Generate more domains with the term three below!

Here are the domains with three in the them. Registered 2024-03-16

  • barmouthtofortwilliamthreepeaksyachtrace.com
  • beatingthebigthree.com
  • castedsendthree.com
  • cultofthree.com
  • elevadaswebthree.com
  • foursixthreetwo.com
  • kingstonthree.com
  • mothree.com
  • ohthreexxgear.com
  • onefivethreerosariesanddevotionals.com
  • slipthree.com
  • sterthree.com
  • three-3s.com
  • three-and-one.com
  • three2025.com
  • threearrowsorganics.com
  • threebox
  • threebridgescorporatehousing.com
  • threecafe.com
  • threecogs.com
  • threehousemerch.com
  • threehues.com
  • threehundrednorth.com
  • threejapan.com
  • threenewssource.com
  • threenine
  • threepeaksyachtraceuk.com
  • threepoland.com
  • threeriversaesthetic.com
  • threesisterspatisserie.com
  • threesixbistro.com
  • threesixtybeards.com
  • threeskiesstudio.com
  • threeskiesstudios.com
  • threestepdrop.com
  • threetrading.com
  • threewayswitchrepair.com
  • tigerionthree.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder