Daily Trending Keyword - safety - 2022-10-25

All .com's with the term safety registered. The term safety gets about 49,500 searches a month! Generate more domains with the term safety below!

Here are the domains with safety in the them. Registered 2022-10-25

  • argjamfoodsafetyconsulting.com
  • behaviouralsafetyworkshops.com
  • bestdoorforsafety.com
  • ctesafety.com
  • cybersafetymatters.com
  • depublicsafety.com
  • dronelinesafety.com
  • eppsafety.com
  • fflsafety.com
  • governmentsafetynet.com
  • homesafety-first.com
  • homesafety360.com
  • kavasafety.com
  • locknsafety.com
  • lodgingsafety.com
  • lucashealthandsafety.com
  • martinsafetyandsecuritysolutions.com
  • mayaworksafety.com
  • mfasafety.com
  • mysafetycore.com
  • nepublicsafety.com
  • ofsafety.com
  • peacelovesafety.com
  • pennsylvaniapublicsafety.com
  • philairlinestravesafetycheck.com
  • phishingsafety.com
  • rootedinsafety.com
  • safety-guidelines.com
  • safety-loft.com
  • safety-shoes-62670.com
  • safety-shovel.com
  • seniorhomesafety360.com
  • seniorsafety360.com
  • technofiresafety.com
  • tegsafety.com
  • woodsidesafetyservices.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder