Daily Trending Keyword - criminal - 2021-01-05

All .com's with the term criminal registered. The term criminal gets about 27,100 searches a month! Generate more domains with the term criminal below!

Here are the domains with criminal in the them. Registered 2021-01-05

  • absolutecriminals.com
  • allcopsarecriminals.com
  • criminaldefenserichmond.com
  • criminalevents.com
  • criminaljusticereformus.com
  • kansascitycriminaldefenselaw.com
  • louisvillecriminaldefenselaw.com
  • miamicriminaldefender.com
  • oklahomacitycriminaldefenselaw.com
  • statecollegecriminaldefense.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder