Daily Trending Keyword - weekly - 2022-11-03

All .com's with the term weekly registered. The term weekly gets about 8,100 searches a month! Generate more domains with the term weekly below!

Here are the domains with weekly in the them. Registered 2022-11-03

  • busandcoachweekly.com
  • freeweeklyprize.com
  • wasfaweekly.com
  • weeklybullion.com
  • weeklyenergiezinfo.com
  • weeklyenergieznetwork.com
  • weeklyenergieznew.com
  • weeklyenergieznewsonline.com
  • weeklyenergiezonline.com
  • weeklyenergisimplenewscenter.com
  • weeklypostandstumps.com
  • wootweekly.com
  • yourweeklyoptions.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder