Daily Trending Keyword - vegan - 2022-10-25

All .com's with the term vegan registered. The term vegan gets about 110,000 searches a month! Generate more domains with the term vegan below!

Here are the domains with vegan in the them. Registered 2022-10-25

  • aprilmasonrawveganpies.com
  • aprilmasonsrawvegansweetpotatopie.com
  • bestvegancupcakes.com
  • burgerkingvegan.com
  • degenvegans.com
  • eticovegano.com
  • freeknvegan.com
  • fruitfulvegan.com
  • glutenfreeveganmom.com
  • greatestveganfood.com
  • greatestveganfoods.com
  • lazyveganpalisadesfarmersmarket.com
  • londonundergroundvegans.com
  • miamiveganlife.com
  • perrovegano.com
  • rawveganbakery.com
  • rawveganspie.com
  • rawveganspies.com
  • rawvegansweetpotatopie.com
  • sluttyvegans.com
  • thebestvegancupcakes.com
  • thegreatestveganfood.com
  • thegreatestveganfoods.com
  • thevegangardener.com
  • theworldsbestvegancupcakes.com
  • theworldsbestveganfood.com
  • theworldsbestveganfoods.com
  • tipvegan.com
  • uthaivegan.com
  • veganbodegaatl.com
  • veganbusinesslistings.com
  • vegandocumentaries.com
  • vegangangster.com
  • veganicha.com
  • veganrcha.com
  • veganriha.com
  • vegansbeware.com
  • vidaveganacvi.com
  • well-travelledvegan.com
  • worldsbestvegancupcakes.com
  • yummyveganfoods.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder