Daily Trending Keyword - savvy - 2021-10-24

All .com's with the term savvy registered. The term savvy gets about 49,500 searches a month! Generate more domains with the term savvy below!

Here are the domains with savvy in the them. Registered 2021-10-24

  • jopasavvyltd.com
  • savvy-india.com
  • savvyinteriordesigns.com
  • savvyjoyboutique.com
  • savvymarketingsuite.com
  • savvyshadz.com
  • savvysolarusa.com
  • savvystealth.com
  • savvytinkers.com
  • shoptechsavvytoolsdirect.com
  • simplesavvyllc.com
  • simplesavvymarketingservices.com
  • simplesavvymarketingsolutions.com
  • simplesavvymarketingsystem.com
  • simplesavvymktg.com
  • socialsavvyconsulting.com
  • techsavvyinternetpreneur.com
  • thesavvychallenge.com
  • thesavvychaos.com
  • thesavvysprint.com
  • vibesavvy.com
  • websavvyprofessor.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder