Daily Trending Keyword - platform - 2021-07-24

All .com's with the term platform registered. The term platform gets about 18,100 searches a month! Generate more domains with the term platform below!

Here are the domains with platform in the them. Registered 2021-07-24

  • adyplatform.com
  • amyplatform.com
  • centricityplatform.com
  • comexplatform.com
  • direct-platforme.com
  • efhasplatform.com
  • hosanna-platform.com
  • jetpackplatform.com
  • kestrelplatform.com
  • kustoskaplatforma.com
  • mcinsightsplatform.com
  • musician-platform.com
  • odisyplatform.com
  • onlineprofessionalmentorshipplatform.com
  • pblplatform.com
  • platform-getmayd.com
  • platformhoist.com
  • platformsocialimpact.com
  • platformwebsites.com
  • powerplatformguru.com
  • psp-platform.com
  • reputationplatform.com
  • safariplatform.com
  • sermoplatform.com
  • smartfactoryplatform.com
  • teknolojiplatformu.com
  • thefirmplatform.com
  • uluslararasievdenevenakliyatplatformu.com
  • uluslararasievtasimaplatformu.com
  • vanguard-platform.com
  • web-trading-platform.com
  • worldwidepropertiesplatform.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder