Daily Trending Keyword - adele - 2023-03-15

All .com's with the term adele registered. The term adele gets about 1,500,000 searches a month! Generate more domains with the term adele below!

Here are the domains with adele in the them. Registered 2023-03-15

  • adelespsp.com
  • assistantadele.com
  • edevlet-aidatmerkezi-iadelerim.com
  • fetesmadeleine.com
  • guiadeleilao.com
  • investradelearn.com
  • janadeleonshop.com
  • justiciadelecionesdecamion.com
  • lafabricadeletras.com
  • larutadelempleo.com
  • mobil-edevletiadelerim-giriswebhizli.com
  • pianoadele.com
  • selectiondadele.com
  • socialsbyadele.com
  • wwvvakfaidatteslimatiadeleri.com
  • wwweiadeler2023mart.com

Trending Daily

We parse all active and registered domains DAILY and perform NLP analysis to find trending keywords.

Search 1,000's!

Our Trending Search offers 1,000 domain lookups at a time! Advanced Mode offers 100 at a time.

Easy to Use

Simply enter a base term and click generate. Go advanced if you need more power!

Try out our FREE bulk domain finder